SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C54F6.9 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C54F6.9
Domain Number 1 Region: 77-307
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.29e-38
Family Nuclear receptor ligand-binding domain 0.005
Further Details:      
 
Domain Number 2 Region: 1-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000214
Family Nuclear receptor 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C54F6.9   Gene: WBGene00016927   Transcript: C54F6.9
Sequence length 311
Comment pep:known chromosome:WBcel235:V:7508994:7510602:1 gene:WBGene00016927 transcript:C54F6.9 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFRRAIVENPFFNCKKLNNCYEVSTNSNHLKCAACRFKRCLQLGMKLPPSNNAILELEN
QKAHKLKKLLNGLILRDAKRCERHLTFYTRSDPSLEDILINKKTMNNDKNENAVTSFEWS
FLAVFNVIEYFSTFDFIENLEYSDKKLLFQCNTFNANVLCGAMRGFKEKRSKMVTPTGQA
ILPDGIAPLLNTTSQMLHRVSCQVIAIIIELKMTNEEFILLNLIFFLRIDNNLSESAKIS
LASHQNFFTNALFEYCQLKYERRAPSRFADLLSLCQIIQKTSSEMKYIGIMLQTFVPGFR
AKTLVSDAYMI
Download sequence
Identical sequences O16442
NP_504933.2.50509 C54F6.9 C54F6.9 6239.C54F6.9 C54F6.9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]