SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F11C1.6b.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F11C1.6b.2
Domain Number 1 Region: 8-19,214-454
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-30
Family Nuclear receptor ligand-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F11C1.6b.2   Gene: WBGene00003623   Transcript: F11C1.6b.2
Sequence length 492
Comment pep:known chromosome:WBcel235:X:13009276:13013953:1 gene:WBGene00003623 transcript:F11C1.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMKMEAVRADRMRGGRNKFGSFYKKDRAHRMQRNAMRVSTVQVPAVLGAQSQAQTFYQP
PEHQVSSSTTDQNNQINYFDQTKIKTEYIKTEYDAHLQSPTLSSSTNQQLSVSDFIMRPG
YLVDPQDSLAVLLGSTIDDPLLRHTFPAAYQLNEVKQEPFDYSEQFIHHSLHDYPTYTSN
TTNYATMMPMTTVSSTQSLVTSTSSTTTGRMTEASSTSPILPLCPAPTEKTVDHFYNSSI
AEMCKTLPDDAQIARIFTSVKGTSKPEKHAFSIQVAEENLKDIVIWAKNDQLFSKLSLDD
QMILLQTSWTTVHIVDITNAMVHGNLLSQYKMSNGDEVPVGLVALLGNQTFVSSWNDVVI
RLRNMGFTNFDYCAFRFLALFDQSMDSFPAVSTARSRVLQSWREVRCTTAFLEIFEQIRR
LAYDSLRYLWNLHSNCPTNWEQFFPEASLVLEMIRTTVNRSASSSVTAITQVPAIQLPTP
QATYTAVPYMAS
Download sequence
Identical sequences NP_001024551.1.50509 F11C1.6b F11C1.6b.1 F11C1.6b.2 F11C1.6b.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]