SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F16B4.12a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F16B4.12a
Domain Number 1 Region: 191-431
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.52e-30
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 32-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-25
Family Nuclear receptor 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F16B4.12a   Gene: WBGene00003707   Transcript: F16B4.12a
Sequence length 435
Comment pep:known chromosome:WBcel235:V:1619194:1621536:-1 gene:WBGene00003707 transcript:F16B4.12a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNSIDFCSASSSTSSNYSSPPAVLDIDQVLEKCQICYQPGHGYHFGAFICRACAAFFRR
CHFSLALDQRKCRLLSGSCQPNKNGRWFCKKCRFDKCLELGMTTTNIQYDRDAFKSSASF
LKNKSVAKRVADRVSVPMTVESALGINPIMIFTYADENKQFPFIDISQLVDKALSSILTP
ISVRKIKKMSNLEQLTQGLDEFQWTQKESVSQIVRLSANDHLNDFQTYMCAAAKWLSYSD
RIRNLDDELKIQILQCIWFNWGRLERIATTAKMRNKRKCGKKQFVFSNNILLDYDEMSSD
LSFWSNYTFEEMKYFFIPTEMFYDEVICEMEEVQPDNMETTFIISLMCFHLTGKQFGGQV
QEEMDQLQDLLSDELHEYYLKKNMTMYSLRLKQLMKIKEKFLKLRYKRCEKYKIAGIFEA
FHTNLSNPEFFMIPA
Download sequence
Identical sequences Q8MNW2
F16B4.12A NP_001294718.1.50509 F16B4.12a F16B4.12a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]