SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F19C7.8e from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F19C7.8e
Domain Number - Region: 323-376
Classification Level Classification E-value
Superfamily SH3-domain 0.000312
Family SH3-domain 0.0053
Further Details:      
 
Domain Number - Region: 60-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: F19C7.8e   Gene: WBGene00017597   Transcript: F19C7.8e
Sequence length 438
Comment pep:known chromosome:WBcel235:IV:4610576:4638095:-1 gene:WBGene00017597 transcript:F19C7.8e gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFKVSSSQRCSSPPWFLHHHLTTTAGGASRPLPLHHRSHSASTPTTTSSITASPSLSQL
PPHQPYHLHQQQQHHQQLHKTMTSALEKCTSSLSEIHRLLRESSTSSYGTMSTNSSIESS
PIEQATSRSARRKWHSAMRFIQGVQRFKTPVMSHKRTTEIREQSVGRTSCESAIVDPVYL
ALKQATGRYSRRGSTTFESASPSPRNLSQVSLQDSGYVEMGSSKANPLLGSTPQLDNAGR
SVGRRRAPKLTQQMKSLSLDCQDMPPRINQNTRSPLISGSKLAPRDYRKPGINGSSDFSD
VERSCSPIVKSRRSSSSALHAGGYIVIHEYSPSNGSSLVLGEKVRVVDNGDPDWLHGFRL
NDRTEHMISFPATCVAQMMAGEQAMRIQQNVFVAEQKLRMYRDQIVFVQPESLVEGKVTV
RTEHNALAPCPLSYLALI
Download sequence
Identical sequences U4PLS7
F19C7.8e NP_001294330.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]