SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F21C3.1a.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F21C3.1a.1
Domain Number 1 Region: 63-156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-18
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Domain Number 2 Region: 162-263
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000497
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F21C3.1a.1   Gene: WBGene00006656   Transcript: F21C3.1a.1
Sequence length 437
Comment pep:known chromosome:WBcel235:I:7269168:7273005:-1 gene:WBGene00006656 transcript:F21C3.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFNDGDNDRIGKEEEHAGLIENQIISQKTKKQLPSWLDRPYHVWRDQFQQDKCCPKKMV
KRELMFASTYVLILNVALILYVLFGCQVFDLRHSSTNNEASFLDRALFCITTISTIGYGN
IAPFDDRGKVICILYCVAGIPLFFMTVATNSVLVVDICNIVHRSYSSQNVENSGFRWYTS
AILLAAHCFIGALIFSLFISITTIGYGDYSPTPEGLFQYIIVTVYLCTGVATMLLFFASL
QKGIMWIHYYGRKVSDSEEAEIWFGGQMMTVKDLVTLVAEKFGSTPEKLREVLHDLDKIL
EVACKQAEEDDDEEDWRSVNNSEALSPPAPRKKTVFLSGSSDGDDCQATIHSFTSTNQRS
IPKDTELAILALGTIQHHLRKPSVRGIHGHHHHPKIPFSKPASDSNIESKEAITSLDLRK
KAHRVHSDGRLLLQQDV
Download sequence
Identical sequences Q19671
F21C3.1 NP_492054.2.50509 F21C3.1 F21C3.1.1 6239.F21C3.1 F21C3.1a.1 F21C3.1a.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]