SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F22D3.6 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F22D3.6
Domain Number 1 Region: 250-477
Classification Level Classification E-value
Superfamily Caspase-like 3.29e-33
Family Caspase catalytic domain 0.018
Further Details:      
 
Domain Number 2 Region: 117-174
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000199
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 2-80
Classification Level Classification E-value
Superfamily DEATH domain 0.0000694
Family DEATH domain, DD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F22D3.6   Gene: WBGene00017702   Transcript: F22D3.6
Sequence length 639
Comment pep:known chromosome:WBcel235:II:6947874:6951300:-1 gene:WBGene00017702 transcript:F22D3.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTNLAELPVRIFKILSEELQKDNIWIKIVEFDEDPIYYMKSTEIESFLKREKCCEQVLR
KWGNRGQTVGSLLARLQFLSRTYEDEFDSIQFHLRRKFKPLRWIPDPEQQVTKEIDEGNI
KLECKAQGFPCPEIKWFTKGSKEPVHIGRVYTILRCKCSNEHQYKCVAKNEIREGSPYSE
IYRKAGKQFSSVIESEYVDVTSCIRDDELCESCKKYEMGRLSQILAEDQEKPENKVSPVR
PNLDITLRAADKVALIMSNCSYVHLPELRTPHCDAQTLADALQKMNYKTVTLADLTLDEM
RYFIRVYQKLIGNGVYAVFYFVGHGFEVNGQCYLLGVDAPADAHQPQHSMSMDWLLSIFR
HKTPDLNLLLLDVCRKFVPYDAISAFVEYSEQFKKFHRAHRNMVYGYSTSGGVGAYEVKG
EVNGVFMKYLKNHVQLEISVIDMLNKVLLDIGDDQKVCDLQVPEIRSTLTHPRSLADPLI
FDGHTASFDNHTIHWRLMHELPTPATIRFETQQLVATIWFQFCGNFTNKVYVFASISDFR
PCQEDTDMGENEELSENALNHRAFVEFPEELHCSDVREYNDDEEGVSMLWILSGLQKIKK
EAGLTCEVHLRHVDDPEKTIEMKNVDIGHILITRIKCLQ
Download sequence
Identical sequences G5EG87
6239.F22D3.6 F22D3.6 NP_495424.2.50509 F22D3.6 F22D3.6 F22D3.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]