SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F43C1.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F43C1.4
Domain Number 1 Region: 200-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-33
Family Nuclear receptor ligand-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 18-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.25e-25
Family Nuclear receptor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F43C1.4   Gene: WBGene00003619   Transcript: F43C1.4
Sequence length 457
Comment pep:known chromosome:WBcel235:III:4230434:4233219:-1 gene:WBGene00003619 transcript:F43C1.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQERSSGGYSGIPPTSKCLVCEHPDGGSAHFGSTSCLACAAFFRRTVSLNIQFQCKKDK
NCVIFHELRMICRACRFDKCVKAGMRRECVQKRRSNKKIPKKHMNMLREDQIKMEYDECK
FECSGDQTDDNSPLSIEKKSPPGLLPNDSPMMADFKFDPSDIPSTSGGSTQRLERSPSPK
LAESKILSMNGEELLRFYVDQLKNSMDRRRMIFTDTALLAVIDDRGDVPFDATEPPPHSL
KRQYESQRFDNLLAFDFCKCCPGFDFLSRVEKAIFFRSCSLAYCLLDIAWITVQAYPEEA
AEPVLMYTDGSVCTVNNLSYGWDDEEDICAHDKKKLFLGFLGRFNDAICRPIRNLKMTHV
EFAALKALCIWKLGYCEFTPSMKVIGKEHEEALLNGLHNYYDDLYGNPDETGMRIGNLIL
LMGTVFEMNQLIMETYKSAELFELFKLDALSKSLLTL
Download sequence
Identical sequences Q09565
F43C1.4 F43C1.4 6239.F43C1.4.1 F43C1.4 F43C1.4 NP_497849.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]