SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F44G3.9 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F44G3.9
Domain Number 1 Region: 38-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-29
Family Nuclear receptor 0.0003
Further Details:      
 
Domain Number 2 Region: 162-303
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000104
Family Nuclear receptor ligand-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: F44G3.9   Gene: WBGene00003701   Transcript: F44G3.9
Sequence length 311
Comment pep:known chromosome:WBcel235:V:16123055:16124781:-1 gene:WBGene00003701 transcript:F44G3.9 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQNAKSIGGILETSTVPLVIQPQIVNDPAQNNITLPITLCAVCGDTSNGNHYGVPTCF
GCSGFFRRTVRNKLVHGCWNGDGNCVIDKANRNRCKSCRIKKCFKKGMNKNAVQPERTSH
SYTVEYVELPSFREYSKGLLPTHSDRLRFQHEHAQHEIDTSSVLVHLKNALQWVQQFSLF
AVLSDVEKSQIILTQWPHLLCLALFENSEKIFIDEKFAQLAEKFKSLELSAQDYFLLKGI
IIFTETKDGTDLKFDRQLDICIGLLNQLHLESSKSKSGRLLFLLGELKSYSTRQLESLLD
LKACEIVISFL
Download sequence
Identical sequences O45521
F44G3.9 NP_507060.2.50509 F44G3.9 6239.F44G3.9 F44G3.9 F44G3.9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]