SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F48G7.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F48G7.3
Domain Number 1 Region: 368-451
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.83e-26
Family Nuclear receptor 0.0023
Further Details:      
 
Domain Number 2 Region: 518-599
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000179
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F48G7.3   Gene: WBGene00003673   Transcript: F48G7.3
Sequence length 604
Comment pep:known chromosome:WBcel235:V:630281:633371:1 gene:WBGene00003673 transcript:F48G7.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILKLGSGLFQTHVQLEDVQHVIEKQMSIKSKIGKDAKFTDIGDGNGFMSRVILVEPNW
TVPDKTFPDKFVLKITSAVHLSGFVDQMVQKSAFGPEQEAAVMEMVEGVDQAQHNREVNF
YEIAQKWNKNDVLLMPKTFFSKKFAASNKAKGILGMEYMSDTVVRHLNCNVKPQELYPVL
KALATLQAEGLHLSDQEVQSISGYDIQQMMGPMLTEDGMKGIFEQLISMDPDRLATNPHR
KPSRGPSSSLPHNSIGSRSPVELGKLAGNVLQVLPRGSWEQQESLFSRAGNIFISGVPSS
KNWTKLKDSYRHYFVTGALLVMPLFGTVAQLKLATADPKHVSEYREVITEKAEHLLDDME
PPLYLSGPCVICDQPSHGRHFGVLSCRACAAFFRRALRRSAKSQDMVCERENCSLEDGIQ
YCKICRLKKCFNAGMDPNKFQTSRDLISSSSQSSDLPSVSPSQSLASILGRPELILFCSL
DRASPSRMIVDVSYLIDKAVNIFETPSYLPSSCQFENSLEKMTFKVEELNSKRKIPNIQF
QTSIIKSVVTQFWEDSFLKTAQWFSTCAEFRELNMKIKTDILKSAWGLWIRLEKMSETSA
QRRK
Download sequence
Identical sequences F48G7.3 F48G7.3 F48G7.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]