SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F52E4.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F52E4.4
Domain Number 1 Region: 14-52,101-174
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 174-293
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000157
Family Voltage-gated potassium channels 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: F52E4.4   Gene: WBGene00006670   Transcript: F52E4.4
Sequence length 555
Comment pep:known chromosome:WBcel235:X:3081133:3085336:1 gene:WBGene00006670 transcript:F52E4.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFILQQLLRFFRLKNFEHAKPFTLHCSLLMLVLLYSFLGGFIFDRIETNAHAEMKRNER
INRTACVSQILHSIHRWSHNQTHKVQYAEDIADCFEPEKDERSEWNFVTATLYGFGIVTT
LGYNRIAPITYTGRMFCIVYGICGIPVTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMS
KASLAGKIYKESSIQVTSLALLCVFLIYVAVGALLLPLLNGELDFFNGLYFNFLCLTAID
FGQLVPIRVELLPITFLYVCIGLAITTIAINIGSEYMKKLHYWGKKMKNAAQTRIWFGGK
TLKVRDLLHAVGKKCGVEPGMIDALDLENVVERTIAMQEGREPPEDLNDEPPREPSPRSI
IHSPCSTRPSNPPMSPPSPREDHPFIFKMDAPAPRSPLPLPAYELDIKKPIFQALSNEFM
NQSAQEKLFNDLDTFQIEINTELVEDHKCESVIIIEPPATFEDMTIQHSLCVEDYEREEK
VPKRFREKKEMYGRDPRKLYETYQEEWDRLERLSDRKHGPRRKSVLNLSNCSPERSVSPS
PIRHSLTGEGHRRDS
Download sequence
Identical sequences G5ED42
F52E4.4 AAC32856 F52E4.4 NP_508526.2.50509 6239.F52E4.4 F52E4.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]