SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F54B8.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F54B8.2
Domain Number 1 Region: 23-249
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-38
Family Nuclear receptor ligand-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F54B8.2   Gene: WBGene00010017   Transcript: F54B8.2
Sequence length 253
Comment pep:known chromosome:WBcel235:V:15812282:15813104:1 gene:WBGene00010017 transcript:F54B8.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIKSLLQNTSLEPLTDFISEVNFNRCTLYLNSIPKYRDYTIGQIVQNDVIEYIPRCHPM
NYRDWFYLVAVSTSDFLRKFPFVYQSSSRDQSFILQKNFVKVASFCEAFRYYLLGEKQLT
FPDGSNILIEDLGIELGERIKFRLVAKCCELQITNEEFLLLLVLIFSSPAIEDLSDTGNL
LLSSFQSYYSSSLLKYCMLTFYQDGPIRFTKLLDVFQVVGQHYEDLNRYFVFLQLTNPEF
QLDDIVKKGFNLL
Download sequence
Identical sequences O45560
F54B8.2 F54B8.2 F54B8.2 F54B8.2 6239.F54B8.2 NP_506947.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]