SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F56E3.4b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F56E3.4b
Domain Number 1 Region: 100-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-28
Family Nuclear receptor 0.00015
Further Details:      
 
Domain Number 2 Region: 222-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-23
Family Nuclear receptor ligand-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F56E3.4b   Gene: WBGene00001400   Transcript: F56E3.4b
Sequence length 390
Comment pep:known chromosome:WBcel235:X:3196307:3199289:-1 gene:WBGene00001400 transcript:F56E3.4b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEDEPLNFSTSKATEESKEGILGVRSIFNTPLLFPPPMFNAGVISPHIAAALAMSFNQ
QRMNASVSPPLDHTTISVNSFPSMGSVKTDSPPTASSPTLCCAVCGDVSSGKHYGILACN
GCSGFFKRSVRRRLIYRCQAGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAVQNERQPR
NTATIRPALDMDPQNFFREYAGAVSAIMGHSNMMKREDSPSSASDGKTEDEKKDSLQETT
MSQLESVLQWAQQFRLFTVLTNSEKRQIILTQWPRLLCISLCEQAEDVSFDDHLTSLMLK
FRRLDVSPAEFNCLKAITIFMKPTEDSQYQFEEQLDQCICLLQQCCLKLDSSPSRFGKLL
LLLAEIQFYPTSYLESLLDTKISQLVSRFL
Download sequence
Identical sequences J7S155
F56E3.4b NP_001263953.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]