SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F59E11.10a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F59E11.10a
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.13e-22
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F59E11.10a   Gene: WBGene00019115   Transcript: F59E11.10a
Sequence length 212
Comment pep:known chromosome:WBcel235:V:8970744:8971789:-1 gene:WBGene00019115 transcript:F59E11.10a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMERAATWLTYFDEFCTLKSEEKMLITKCMWLLFRRLERSAMTADLRRAKKCQKSEYAM
KTDSLVSMETKYEFDWLSHFSAEQIKVFLGSSSGMYCEELTNCIMEVQPSDEELCFIICD
LCFQYLGIKVGGEIQQKLEGLQKILSDNLHNYYLERNREHRYTYRLSQLMKISQQYNKLM
EEKRRVGVVGEVFGVFRVKWSHPDIFKYARFE
Download sequence
Identical sequences O16752
NP_001256112.1.50509 F59E11.10 6239.F59E11.10 F59E11.10a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]