SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H12C20.3b.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H12C20.3b.3
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-16
Family Nuclear receptor ligand-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: H12C20.3b.3   Gene: WBGene00003658   Transcript: H12C20.3b.3
Sequence length 103
Comment pep:known chromosome:WBcel235:V:11574790:11575708:1 gene:WBGene00003658 transcript:H12C20.3b.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEINFNEFAAFKAITFLNPDADISLESKHAINEERVLITKQLYAYMVQKDGLEKAIYRFG
RLILMGTSMSKMACESKEAVWIADFFENIGFTSFAKELIFGDH
Download sequence
Identical sequences H8ESE6
NP_001256335.1.50509 H12C20.3b.1 H12C20.3b.2 H12C20.3b.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]