SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K10B3.10b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K10B3.10b
Domain Number 1 Region: 118-268
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-35
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 2 Region: 644-798
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-35
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 749-905
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-34
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 4 Region: 538-691
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-32
Family Spectrin repeat 0.0000753
Further Details:      
 
Domain Number 5 Region: 221-375
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-32
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 6 Region: 1251-1389
Classification Level Classification E-value
Superfamily Spectrin repeat 1.82e-30
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1360-1505
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-30
Family Spectrin repeat 0.0000345
Further Details:      
 
Domain Number 8 Region: 1470-1616
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-29
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 9 Region: 1890-2044
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-28
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 10 Region: 331-480
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-28
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 11 Region: 29-157
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-26
Family Spectrin repeat 0.0000527
Further Details:      
 
Domain Number 12 Region: 1615-1732
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-25
Family Spectrin repeat 0.0000379
Further Details:      
 
Domain Number 13 Region: 1728-1834
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-24
Family Spectrin repeat 0.0000286
Further Details:      
 
Domain Number 14 Region: 2050-2164
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-23
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 15 Region: 2268-2429
Classification Level Classification E-value
Superfamily EF-hand 1.78e-22
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 16 Region: 1164-1263
Classification Level Classification E-value
Superfamily Spectrin repeat 2.78e-22
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 17 Region: 1050-1193
Classification Level Classification E-value
Superfamily Spectrin repeat 1.69e-20
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 18 Region: 982-1050
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-20
Family SH3-domain 0.0000649
Further Details:      
 
Domain Number 19 Region: 906-975
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-16
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 20 Region: 2166-2275
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-16
Family Spectrin repeat 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: K10B3.10b   Gene: WBGene00004951   Transcript: K10B3.10b
Sequence length 2432
Comment pep:known chromosome:WBcel235:X:3117455:3127073:-1 gene:WBGene00004951 transcript:K10B3.10b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSNDTHAPPEPVLEVPPPQEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA
RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD
KTGNAMIQHNHFASEHIKKRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEILY
WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH
DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY
GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW
NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH
QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY
EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI
NALDEFATKLIQGQHYAADDVAERRQALLDRRRRLLDRARQRGNALKESYKRQTFDRDCD
EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH
FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS
EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ
QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI
KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR
TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK
GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDW
WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK
LEEACKGYQLLREANDLAEWIKSRTNMAEEAVAAQQEIGTDLEQVEVLQKKFDDFKGDLK
ANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGSAHEVQ
RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA
NRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIA
SMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDI
ENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD
NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKE
ALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAE
LHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEAN
KQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMN
EQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEES
WIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAG
VGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGS
DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLR
ARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILL
TKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEAR
RQKLLKMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGE
FQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAR
EHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQ
LRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVS
EEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPN
RDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFC
IRRMKPYMDAISGRSIQGGLDYEQFVHALFQS
Download sequence
Identical sequences Q21408
K10B3.10b K10B3.10b NP_001257000.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]