SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K11C4.5b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K11C4.5b
Domain Number 1 Region: 224-399
Classification Level Classification E-value
Superfamily MIR domain 9.02e-40
Family MIR domain 0.001
Further Details:      
 
Domain Number 2 Region: 1079-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-21
Family SPRY domain 0.015
Further Details:      
 
Domain Number 3 Region: 4370-4448
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000536
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 4 Region: 670-800
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000372
Family SPRY domain 0.042
Further Details:      
 
Domain Number 5 Region: 108-187
Classification Level Classification E-value
Superfamily MIR domain 0.0000000183
Family MIR domain 0.02
Further Details:      
 
Domain Number 6 Region: 2303-2383
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000876
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Weak hits

Sequence:  K11C4.5b
Domain Number - Region: 436-543
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000157
Family IP3 receptor type 1 binding core, domain 2 0.007
Further Details:      
 
Domain Number - Region: 1580-1703
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.001
Family SPRY domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: K11C4.5b   Gene: WBGene00006801   Transcript: K11C4.5b
Sequence length 5273
Comment pep:known chromosome:WBcel235:V:6901687:6929038:-1 gene:WBGene00006801 transcript:K11C4.5b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKEEQGGGEQDDVSFLRTGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENV
SDKDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQS
EMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVA
TERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTI
PENWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLG
VLDNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVK
TQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVL
NKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRS
RQDLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGN
HYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLE
KVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLG
VVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFY
SYGFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDG
YFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIF
SGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRS
ETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQ
QQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRS
PHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTY
RAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQG
AETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLG
SGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGS
ILEVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETI
RRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLGSKDSHESDDDRRSRTNSK
QPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKN
FRDSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLEEETEEQEPIWVMQDQF
HDEDTVSASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMEREKKGSIIPMDAQLD
VLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKC
RFSEADHHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQV
GSTDTGIKFKLEPGAMLFPAAFVTPTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFC
PPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDIL
EMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGF
HDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMA
SEPVKKHVSREDEMKLLPPSVDFEALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPL
FKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQLELAEPVKIQLVSIL
DHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKE
QMFRLLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQ
LALIESEEGSWVDSFARIVVKVPPPVLEEGMEMQKKGTQNFREIIVTMLREWAQADFIES
KSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHT
EEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKA
PIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAY
SSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRF
CVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAIALSEDIRLLENDSH
PSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDS
LRARAILRSLISLDDLGQILALRFTIPNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMV
ASLASEVSNTRRSQTFTSGTNLAKRGLPCVEEVDTDDSKSSDYASVHTSFSSGNELFAPK
AEKEKVDVLKLNENKYPIIQRRRSSRFNPIDNTGPLPGLLPNHKGSVLLFLDRVYGIDQQ
DMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHH
SALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMND
MNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFG
KALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSRCEINRDLEKMTELF
AEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMA
WNYSFEMMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLI
WAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQS
QNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVK
FFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFG
SVAKITVKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCADDLYASVNELKKCIYYSE
IEEYDDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAAC
YKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKF
SVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCS
YMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRV
NFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEEHMRTHPDDADEGTVAEDNARL
VRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQ
FEEDAAATGGGDMKTGKAAIAERKKKRREGQDKMKEYFDRNGRPIIKKDKHAASIVIACL
KRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLS
LYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVLTLQRKRMA
ISLITASHLYKTELHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIM
EEGVPIVASSEDTKEKETNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKS
IHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVA
QTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKVPT
DTNVDAHGANELLLRHLSSKIRHRSRQDRLGAQAEGLGMGAELASGDNQNLNDADFTCSL
FRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVID
EGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLY
KNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDM
FLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVD
YMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIM
GSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIF
EMQHAAAISSGDSDTKMERAIKQRDYFLQQTSADHISETFKSGYNYGISAASALSPQNIS
TTMRNVSSSVRQMSWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFGYFLTTSSEEEEA
ARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNSLPDFVPPERPET
PETVLEEEKPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAE
SNSTKSRGSILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDED
ALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREK
EIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKD
QVDEETLTSILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPF
FYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEG
EEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVII
ILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFA
NYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Download sequence
Identical sequences K11C4.5b NP_001256075.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]