SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K12H6.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K12H6.1
Domain Number 1 Region: 179-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-36
Family Nuclear receptor ligand-binding domain 0.00025
Further Details:      
 
Domain Number 2 Region: 34-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-27
Family Nuclear receptor 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: K12H6.1   Gene: WBGene00003709   Transcript: K12H6.1
Sequence length 708
Comment pep:known chromosome:WBcel235:II:2794938:2800600:-1 gene:WBGene00003709 transcript:K12H6.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKVDTSSLENMAASISRKSSLSQIASHSGGSDTCKVCGDGNAKTHYGVVTCFGCKGFFR
RTLKRPSEYTCRHNGHCVVDRHERNSCRFCRFKKCIEVGMDPKAVRPDRDATGRHYQGRQ
RRSKLSAEDEGEVDAEWMRKLPVDMRTTLMQLLNIDLIVGGGDGHTEPSKIYPLPFATSI
RQLLEDPTLLDGKRTEMRYETFREINPDELPCIAHRRLIAMIDWADHLFDMMDVNNMDDK
IAIVKASYGPLMIFSLCANTSRHKMSDIVCLSTFGYISRYAPNGWAEPYHFGNQLAERCI
DELIDPLKKMNLKEEEITLIKAIIVLNPYLKTLTQDGSEAIMDLRDRIQETLYHVVRETH
PKEVASSRFGNLLLFVPSVMMLGRLVTENLSFVDSFGQMNDALVHDLLQEAPKVEQNRSP
TNTSPPTTSGMDTSPSPPIMNHHGVSSQDEQLGGAQHDLGRRHSEPRMVHSSSSSSIESL
NGSYQCSSDGGASYQNQIGTLPYNLSCNSLPAQVNDFGVSLNGASSMPNLEMAECDPDYN
VTITPDMYGDMRQAMNVAHGGMEIDESQVGNNGMGTPNLERRDSMQLPQSPTQPMFYIST
VESTKHKFTVTTASYDRFQNAPNGHAYGENGYQNGVGGMPQQSSGSFGQMPSSGSQQHEA
LCKTNSLPPQYMSQQQPQNAQNYDQMMYVAQNQMECDDGNYINFNPPS
Download sequence
Identical sequences G4SCE4
K12H6.1 NP_494368.2.50509 K12H6.1 K12H6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]