SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M02H5.7 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M02H5.7
Domain Number 1 Region: 166-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.97e-35
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 23-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-28
Family Nuclear receptor 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: M02H5.7   Gene: WBGene00003713   Transcript: M02H5.7
Sequence length 412
Comment pep:known chromosome:WBcel235:V:451451:453755:1 gene:WBGene00003713 transcript:M02H5.7 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPGSSTCSPPDLTVIPKISPKKCQICENPAHGKHFGAITCRACAAFFRRFGISKKFKP
CKLENKCTFRKNGYFSCKKCRMQRCLQFGMTIDNFQFDREPIYRKDLEIPQTVDTFSGRP
SLILFSAPSGSSSSKHYLDVQFLVDKAIEVLLNGSETPLQVPNVLQKLAIGLRNIRGPKE
KTSKVITKVGREEVFGIWEEDMLRTAKWLTYFDDFQRLPNSVQIEILKGVWSLFSRLENL
ATTARARKRKLCKDDLVMSYMNKNLVISDLKTIEVDLSWCSKYTYEQLKFFDQYDGVRQL
DSLIKAMLDLQPTNEELCYMICQLCFHQVGKQLHGPILETIEKLQEVLSNHLHDYYVNHL
IQPKYSMRIASMMKINNTVDQCPYRDRVKGELMRVFEVFHVECSHPGTFLNA
Download sequence
Identical sequences G5EDC3
M02H5.7 M02H5.7 NP_503207.2.50509 M02H5.7 6239.M02H5.7 M02H5.7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]