SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R01H2.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R01H2.3
Domain Number 1 Region: 120-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 215-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 455-493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 295-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 370-412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 253-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 420-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000038
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 189-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: R01H2.3   Gene: WBGene00019811   Transcript: R01H2.3
Sequence length 548
Comment pep:known chromosome:WBcel235:III:7058518:7060597:-1 gene:WBGene00019811 transcript:R01H2.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQAGNAQRGRFDEEPMSLGEKISHRMDQLKEIVSSSCPCAGKFPPVAIVLIVALIILG
VIIAVPLVIFLSPSAQAMSSGTRDLSSHSIRHPKVWPKTEKVQDDDLSAIQMTSLLPPNV
STCSGFGFACTGSIDMIIPSSKRCDGLKDCSDGSDEENCKECQSIYSCRAHIEEESEKKD
KTSVLPTLICLTAEKLCNGVENCPDGSDEASCRSKCSKDQFKCSGSDACLPISVKCDGVS
DCENESDESNCNKCQKGAHKCGKNCIKASKVCDGIPDCDDGSDEHQCDCKTCSGSEKALC
EDGTCIMRSQVCDGKHDCLDGIDEENCPGSCSNERFSSKLKLLTCDDGNQYSEVEACSGL
VEACELNCPKCDPKHTFTCPAVGGIHNKCIKRSKVCDGIFDCEDGADEKKCTPVKECVVE
SSIQFTCDNKCLESSRRCDGVWDCEDKSDEKGCDKCPSRSFKCSADKKCLPFHTRCNGVA
ECSDGSDEHKCSCQECLGTHHDTYMCSESNRCLKRGEVCSPYSMCPNATYIDKAYCASLA
LKNSGLRP
Download sequence
Identical sequences Q21629
R01H2.3 R01H2.3 R01H2.3 R01H2.3 6239.R01H2.3 NP_498537.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]