SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R04B5.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R04B5.3
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.00073
Further Details:      
 
Domain Number 2 Region: 135-382
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.82e-26
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: R04B5.3   Gene: WBGene00011002   Transcript: R04B5.3
Sequence length 387
Comment pep:known chromosome:WBcel235:V:10080119:10081739:-1 gene:WBGene00011002 transcript:R04B5.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLNFQFFEQGLSQKETKKPNCAICGDVGDGHHFGLDACRACAAFFRRTVALGKKFECR
QQGACKINTIIRSICKSCRLNKCLNLGMKRSCVQPRRDKPQKEEKLILPSMNVSPADIEV
SCIEVPIAVEAMPILQKMLANYEKLKNSRNIIHRREGDNIFEKRTPRSLKFRETLEILSN
EMSLVADWIGWCFNEFEFLPTDQKSILFSNFSVNFIVLERAFLTSKHNNLNQWVLQSGDY
IQIDNLEEFFTDEQLKIDGTKLAKLFKPSLEQNDNFHKLLKSEKIEMYDFLVFVVLLFWD
HGIVGQTEECREISKKMKSNVTNEYIYYLKYIQKNENPVCQLTMLVSILTCLQRIVCRLR
EDMSLAHVFDGYTLPPNLYNIIIGRYI
Download sequence
Identical sequences Q21700
R04B5.3 R04B5.3 6239.R04B5.3 R04B5.3 R04B5.3 NP_505588.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]