SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R07B7.13a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R07B7.13a
Domain Number 1 Region: 164-407
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.91e-42
Family Nuclear receptor ligand-binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 41-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-25
Family Nuclear receptor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: R07B7.13a   Gene: WBGene00011097   Transcript: R07B7.13a
Sequence length 410
Comment pep:known chromosome:WBcel235:V:12092026:12093862:1 gene:WBGene00011097 transcript:R07B7.13a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESNSFLPDIKVDERYCESTSNSQQSEITNETSRNVLPEKCEVCGNPAVGYHYDVATC
NGCKAFFRRTVITGRRVICRRRKNCLVEMEPKNRRICPGCRFSKCEEVGMNPRAIRAEIS
SGGKILKDELIAKREPRSKIMLSPKSKENEVSRLISDLNLIENQIDELFNSSLPINYGDW
RTLSEIIQMKPYLKVSKIPNLKLIRNQMNAELAGYAHNGSLAMVEYAKMLDFFPKISKET
AIKLVKHGLFMCGSLSFSRRSIQKYNSDILRFTDGSVAGKPKTNWNGVMLDHRRIAQKTL
HSILRVKLDYVEYLFLKAITMCNPAVSDFPAEDQKIIDKHRFNYAQSLLNYCLKQHGQIH
GADRFASILSIMSIMEVQQKEEKSCFFVFRSIYSEFDVFVSPLFDEISNY
Download sequence
Identical sequences Q21803
6239.R07B7.13 R07B7.13 R07B7.13a R07B7.13 NP_506033.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]