SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R07B7.13b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R07B7.13b
Domain Number 1 Region: 164-326
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.65e-27
Family Nuclear receptor ligand-binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 41-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-25
Family Nuclear receptor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: R07B7.13b   Gene: WBGene00011097   Transcript: R07B7.13b
Sequence length 336
Comment pep:known chromosome:WBcel235:V:12092026:12093549:1 gene:WBGene00011097 transcript:R07B7.13b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESNSFLPDIKVDERYCESTSNSQQSEITNETSRNVLPEKCEVCGNPAVGYHYDVATC
NGCKAFFRRTVITGRRVICRRRKNCLVEMEPKNRRICPGCRFSKCEEVGMNPRAIRAEIS
SGGKILKDELIAKREPRSKIMLSPKSKENEVSRLISDLNLIENQIDELFNSSLPINYGDW
RTLSEIIQMKPYLKVSKIPNLKLIRNQMNAELAGYAHNGSLAMVEYAKMLDFFPKISKET
AIKLVKHGLFMCGSLSFSRRSIQKYNSDILRFTDGSVAGKPKTNWNGVMLDHRRIAQKTL
HSILRVKLDYVEYLFLKAITMCNPDLIMHKAFSIIV
Download sequence
Identical sequences N1NTC6
NP_001294679.1.50509 R07B7.13b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]