SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R08D7.6a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R08D7.6a
Domain Number 1 Region: 348-687
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.2e-95
Family PDEase 0.0000109
Further Details:      
 
Domain Number 2 Region: 176-332
Classification Level Classification E-value
Superfamily GAF domain-like 1.49e-28
Family GAF domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: R08D7.6a   Gene: WBGene00011146   Transcript: R08D7.6a
Sequence length 831
Comment pep:known chromosome:WBcel235:III:8975065:8981897:-1 gene:WBGene00011146 transcript:R08D7.6a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLELRRNSSPSSAHPSPQTNCQNSQRGDGLHHHHHEAASGSTCCGGMTVFTGANAAKSSN
EPAGSASPTVWRKTSHPPLHFNNNETRNRNLQMQLKNRGTKDDWGASLRYDIEEPTSSGL
LELLPDVPIVRKLSRPLVKMDDQDDACSVASNESDRTVLSPLVPMSIFDQFLCLTNNLSA
LISCIIAEAKKNTEAEDYAVFLHDEDNKQMVLFNNETMLMTGKKFDMGYGIVGKVASTMR
TMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENGFSRHDEKY
IKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWR
YFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVP
YHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQK
TPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISA
HLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFA
QGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPEGRTTSEAIDANH
LCWVALDEEVRNNPSATNTLEYLRDENLERRIYDRVRKQDPRAAEIASKRFEPVYANGSV
PQTQDILDHRFDGYDKKYQIGCSGGQNQSNGKQQQIRSLQKIRSKTSEDDALLKPMDNGG
SVAASSTRRGSRTPRRLWRRARQLISSMSSSCASCSPLPSRRQVSEDSESC
Download sequence
Identical sequences P30645
NP_001022705.2.50509 R08D7.6a R08D7.6a R08D7.6a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]