SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R09G11.2d.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R09G11.2d.2
Domain Number 1 Region: 72-157
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-30
Family Nuclear receptor 0.00042
Further Details:      
 
Domain Number 2 Region: 226-271
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000122
Family Nuclear receptor ligand-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: R09G11.2d.2   Gene: WBGene00003600   Transcript: R09G11.2d.2
Sequence length 312
Comment pep:known chromosome:WBcel235:X:17519851:17524746:1 gene:WBGene00003600 transcript:R09G11.2d.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGTLADQLQSHLANYGQPMVNSQRNEDPSMYMNGSAASVSHTNGSSSMGNDQKFPSYKR
MAQRRKVPEGELCAVCSDLATGYHYGVASCNGCKTFFRRTIVSEQTFICQYNGNCDVNKN
IRCACRHCRFNKCLLVGMDAKAIQNDRDRIGPTKKIKMSSGSDDEQATTPHRLQDQEIID
QLTQVEGLCQELRRCIIPEVTGVTHALTSPCLLFETTDLKVDVSLTNTIFKELFPASMND
IRMWNIREMRICIEWAKTFDVYQRLNLFDQVGTRNFGCWGIEVFILPKNYAVGKLGKSEV
VFSQKILEQLQF
Download sequence
Identical sequences G8JYA7
R09G11.2d.1 R09G11.2d.2 NP_001024856.1.50509 R09G11.2d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]