SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T01G6.8 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T01G6.8
Domain Number 1 Region: 206-438
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.74e-40
Family Nuclear receptor ligand-binding domain 0.0088
Further Details:      
 
Domain Number 2 Region: 35-126
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.73e-28
Family Nuclear receptor 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: T01G6.8   Gene: WBGene00003720   Transcript: T01G6.8
Sequence length 440
Comment pep:known chromosome:WBcel235:V:480840:483339:-1 gene:WBGene00003720 transcript:T01G6.8 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIATSSTSPSIFYTPSISPMEEDMNCQELVVNLYTCQVCALPAHGNHFGAISCRACAAF
FRRACTGTKTTYKCKKQNNCDIWENGRYKCKKCRLDRCNEVGMDPGRFQFDRDLISATEK
YPNSKNFRRTFGMSRLPETIEHFLGRPHFIIFLERHIYSHSEKNFVDLQHLIAKASKLLE
LGSEKPLIARNNLEKLALGLNLVRDQPAGSHDVQLVTKLGKDEALTFWETDFLTVAKWLT
YFDDFQLLPHNQQILLLKSVWHVWNRLEKLALTATSRRQNVCEQKQLMLTYNSVCNPKTI
ELDYSWFTKYPKEQLCFFFDEMEDYMLTSALDPLTSLEPTDIELTYMLCQLCFHYAGKRY
GGEILEVTEKFQENLADNLHDYYVNELNMPRYCGRLNQMLKINNLIQQDIWEKRAKHELA
KVFDIFCIEFSHPEMFEDTG
Download sequence
Identical sequences O16963
NP_503216.1.50509 T01G6.8 T01G6.8 T01G6.8 6239.T01G6.8 T01G6.8.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]