SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T03E6.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T03E6.3
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-21
Family Nuclear receptor 0.0028
Further Details:      
 
Domain Number 2 Region: 116-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.79e-18
Family Nuclear receptor ligand-binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: T03E6.3   Gene: WBGene00011396   Transcript: T03E6.3
Sequence length 342
Comment pep:known chromosome:WBcel235:V:16578459:16580524:-1 gene:WBGene00011396 transcript:T03E6.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIICGSTEAELHFGGISCRACAAFFRRYHFAKRSDILCTCKTRISSSHPCRKCRIEKCK
EAGLTIEKIQVGRDKHSNTLELSKNRQSLLAARVVFRETWNIHCAVFNWKQFEVTRNEVN
NGVFDELNVFELSCSVSKDIDLTWKMIYKLFPSTGKLKKSDKIALLRNFIPKLWQIDPLL
NYIRNFKKYEAMEQPDLEQIIINFYKGAMPEKGSMTDSEIVRIFKPFWSFYFHNMIQPII
FMKLKEQEFMAIIWLMFFDNGYSNISDECLEMCWNIRKVILRELRNYQIDGNCEESRLFE
TLESLEYIEKGERKLMEEMLICEINDLRIHDDFREILKESKL
Download sequence
Identical sequences Q9XU11
T03E6.3 T03E6.3 NP_507194.2.50509 T03E6.3 6239.T03E6.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]