SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T05B4.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T05B4.2
Domain Number 1 Region: 133-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.54e-32
Family Nuclear receptor ligand-binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-26
Family Nuclear receptor 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: T05B4.2   Gene: WBGene00003647   Transcript: T05B4.2
Sequence length 374
Comment pep:known chromosome:WBcel235:V:4131925:4134945:1 gene:WBGene00003647 transcript:T05B4.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVARERKYCSVCHQLGDGYHFGAIACKACAAFFRRTTSMNLAPKFVCRKKNECVIKMSS
RDSCKSCRYAKCLHVGMNPEVVQAIQQAAKQANSPGIESLPSCSSSPASCNSPILSLELG
DYDQMTPTLCGVMESYQKLYKKRYDLHAPKLTPRATNYGEFCKIYSNDVYLQFEFLEGSF
PQFKEMGGFEKKHVFKYFFVSFLILEMGYRSYQEGTDAIVLANGDFIDTMNLDEFYYDPE
SLEKCKPTDAMKMYRPNFDQMKRNVFQPLSHQKLSLIEFLALVSLCTWNESLDGQPDCYY
PSCRPVRQSVIADLKAFYEKDSPDVDPAYRLSGLLMLLPALERSVELFLQTMEVKRLFRC
FPFHDKIYKIIDGQ
Download sequence
Identical sequences O16425
T05B4.2 T05B4.2 6239.T05B4.2 NP_504153.1.50509 T05B4.2 T05B4.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]