SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T06C12.13b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T06C12.13b
Domain Number 1 Region: 167-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.39e-37
Family Nuclear receptor ligand-binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 22-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-28
Family Nuclear receptor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: T06C12.13b   Gene: WBGene00011520   Transcript: T06C12.13b
Sequence length 409
Comment pep:known chromosome:WBcel235:V:15894447:15896767:-1 gene:WBGene00011520 transcript:T06C12.13b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTPSTSDTSSESSTSPATIVLCKVCALSAHGSHFGVLACRACAAFFRRTVVLERQKQY
KCKKGKNECPVDTAERYQCRLCRYNKCVDLGMTPENVQFNRESASRTRKRKNENSIAQTN
SFKLIPRSDNAFLGKPRTIMDISSLSTKIKSVLNGKTYNLDSAAKKMNSLEAAEYALKKW
RSQQKTEDKMEKVGELPVRQLFVIFEKQMVMIAEWLIHNPDFRMLDEEEKYLYFKAVWNM
WRRFERFEMSVKMFGNQKFAISNEKLMVMDSCIDYSEITDLPNSKVAEMFRLTRSKLFHQ
LAKPLMELNPSSIEMAYMLTQLSWQIAGKKMQGNVIEIGERVCDNLADDLHSYYQKNEKR
SNYAGRLVRLMNIVNAMKKIHLQRKNTMELARIFEMFKVDFSDPDIFDC
Download sequence
Identical sequences L8E924
NP_001263903.1.50509 T06C12.13b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]