SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T09A12.4c from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T09A12.4c
Domain Number 1 Region: 456-686
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-29
Family Nuclear receptor ligand-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 268-351
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-25
Family Nuclear receptor 0.00092
Further Details:      
 
Weak hits

Sequence:  T09A12.4c
Domain Number - Region: 136-223
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: T09A12.4c   Gene: WBGene00003656   Transcript: T09A12.4c
Sequence length 733
Comment pep:known chromosome:WBcel235:IV:8226341:8236602:-1 gene:WBGene00003656 transcript:T09A12.4c gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPINEPTATTTSASSVWQGMTQLKSQVDLINIARGILSTPATTSTSCLDIQNSTPIIGS
LASGKSQTPILTATMTPQIGLTGLGSLTSLPPELLLQFARLDGFNLLPAVGSPAIPSSSS
CSEPSTSQASTVVSAPTLPPPSPLTSLPQKPAPLMPSGHVTTVDQQNRQQHQQQQRQQQQ
AQQQNSMARKYSMDTIQHHTMQHPHQLQYIPNHFMTASTDVFAAMDMSQKQSSPPGIFKI
VAAKNEPSSSSNSQPGTPAMGDRRAVPACAICGTDSTGIHFGVDACAACSAFFRRTVVLN
KDYSCNKGGKCTVVKDGSAGQKCRACRFRKCISSGMDKNSVQHRRDAIGKYSAGVKRELS
PDAEFEPSAKVSTVSEPSTSSGPSGGFNQNVSSPAGIPRVPSTLRTTQASTCMNSACGQK
SVLHELICRQNFLTEQRQLFYAGCLGDWFRKPSSIENQTLSELTDFSSCMFHLWKIEPRL
AADFMNRNRYLDPLPIVEKLKIYRNFVIMRQSVEEPYLTWRHGGLEKRWFVMPNNTYIDF
NNIAKYFENGALKDLKLDYETTTNLFLPSFTHAMDTIGEKMKKNNITETELTILLGLVLL
DPGIYGIHESTRKFLKRIRDQLIHDVYMYYEDEMSHLYDPEIRMADIFMLVAAIKIHSIK
TSENMHMLRVFDLIPADACFNQMLDVESVNVSPDGQKDSEAEQGPSPVSVPEAARGSYQD
DDMPPVLEKNCDL
Download sequence
Identical sequences H2KYJ8
T09A12.4c NP_741462.1.50509 T09A12.4c T09A12.4 6239.T09A12.4c T09A12.4c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]