SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T09D3.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T09D3.4
Domain Number 1 Region: 185-427
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.75e-27
Family Nuclear receptor ligand-binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 47-130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-26
Family Nuclear receptor 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: T09D3.4   Gene: WBGene00020385   Transcript: T09D3.4
Sequence length 436
Comment pep:known chromosome:WBcel235:V:5354062:5358225:-1 gene:WBGene00020385 transcript:T09D3.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPRYEYANLDISSFERSPTFEQPPSYPTYDQHVQFLPEIENNGPKQKCRVCNLEAHGMH
FGVQTCRPCAAFFRRIVVLDLKYTCVSNTQKCNVDGRGRNVCRDCRYKKCIAVGMTTDNV
QYNRDSHNNKNSSGSGGGRGRGKNKRNVMMMLTDEEEAAGSMMALHRRVAILKYSPPEMI
NQCSINQLQRLTHSLVLYRQNQQSANQIKFCDTINAFTDGKAHLQRKSEKFSKWVKCVDF
FDKLSDEQKIDTVKMSFTVFDRLERAQMSVKIFGEKSITEKKTTLSSYCAVDWKNVKINP
ETAINTEQANNYVKAEFHAHVDSIIDEVCKPLYELQLSDTETAFILVQVLVYHGGEKVTP
ELVKMFDQLRETIATDLHLYYTKESQTGTDTNRILKMMSVVNAMKKIHADRVRKSDLIQI
FNIYKVSEKRTDFNCS
Download sequence
Identical sequences T09D3.4 NP_504427.3.50509 T09D3.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]