SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T12C9.5b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T12C9.5b
Domain Number 1 Region: 71-313
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-37
Family Nuclear receptor ligand-binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 11-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000296
Family Nuclear receptor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: T12C9.5b   Gene: WBGene00003699   Transcript: T12C9.5b
Sequence length 318
Comment pep:known chromosome:WBcel235:II:4433464:4435365:1 gene:WBGene00003699 transcript:T12C9.5b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFTLEQKLADIRCMCRACRLTKCIEVGMNPVGVRQKPGSFRKSKELISPSSSNHDEFSR
MPILSKMKLNYENMRNARKALHNEVGENVFEEKIPKEINYKESVQQGMKDYTLMPEWVSS
CFDEFRTLSADQKNILFRNSYIPFFMMETAFLSHINNMPDSVIFPSGDYCDMKNLERYYN
STNFEKKISTEDIENLFKPFYDNYKRSLLLPMMNLQVDIYEFLTLFTLLHWDTGLVEITD
ECLEIGTKVKAEVFKELDFYLTNVKKVAEPSVRIGTIVNLLPAVHKSVRRIQDDMEMTKV
FNIFSAPNEFFDLVTGNF
Download sequence
Identical sequences Q7JP54
T12C9.5b NP_001022341.1.50509 T12C9.5b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]