SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T19A5.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T19A5.4
Domain Number 1 Region: 180-424
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.87e-36
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 22-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-25
Family Nuclear receptor 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: T19A5.4   Gene: WBGene00003634   Transcript: T19A5.4
Sequence length 428
Comment pep:known chromosome:WBcel235:V:8961902:8964099:-1 gene:WBGene00003634 transcript:T19A5.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSISSPSTSSSASSTPKLISEKCLVCFQPSHGNHFGVDSCRACAAFFRRVFVTHKQQFP
CREGDNKCTPDEWGRWSCKRCRSDKCFALGMKPDNIQRDRDRFIFSDNFRDDRKRKTSES
IVPLSVERFVGKQLVTTYTSTGSGKNIEYITFFDLTPIIKDADYILKRIPKLEKSVKVKS
SLEQLAFGLQEVRKEQLFESVPELRKIGKMETWDNWVKGMRRAGEWIMHFEEFRQLEQEE
KMVILKCMWHLFIRLERISMTAEMRRMKLCDDKEFIYGTEQRINYDTLEIDRDWFSEATD
REVRSFIGPLPRWFCETIIDALMELRPSDVELSFMLCNLCFHLTGQKLGGRIQEITDRLQ
DVLANDLHKYYLAKDKYSRYSYRLTKLLSLNRQYKNDLEIRRQGIFLANTLNIFRVKLSH
PEMFQFSC
Download sequence
Identical sequences Q22555
NP_505313.1.50509 T19A5.4 T19A5.4 T19A5.4 6239.T19A5.4 T19A5.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]