SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T27B7.4b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T27B7.4b
Domain Number 1 Region: 90-318
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.33e-39
Family Nuclear receptor ligand-binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: T27B7.4b   Gene: WBGene00003705   Transcript: T27B7.4b
Sequence length 322
Comment pep:known chromosome:WBcel235:V:2288487:2294798:1 gene:WBGene00003705 transcript:T27B7.4b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASKFQYDRDAISAIKHPKIFPSVSYYVGRPEFLMFSDSNVTSQKTFIDVQNLVFEVSR
YLDHGCETPIYAENQLKKLTLGFKLMQFDYQNVKFFDKIGKAEFIDIIEYYFLTVAKWIA
HFDEFRKLDQSLQIKLLQAIWHVWSKIHKCASTAFYRKSNPNAKPTQKILRNVCMDRMHV
HKLDTSWMSDYPTEHVTRFMLTHHVYDFKIVESLLKLDPTDVELTFMFAQLCFEYAGKRF
QGEILKITDHFQQVLSNDLHHYYITDQRRERYFQRLTDLMKVNNLIQRSIWETRPHRELG
RVFEISKLEFSHPEMFDDSGFC
Download sequence
Identical sequences B7E2K2
T27B7.4b T27B7.4b NP_001256015.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]