SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y105C5B.19 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y105C5B.19
Domain Number 1 Region: 53-174
Classification Level Classification E-value
Superfamily PapD-like 7.06e-24
Family MSP-like 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y105C5B.19   Gene: WBGene00013658   Transcript: Y105C5B.19
Sequence length 484
Comment pep:known chromosome:WBcel235:IV:15981575:15983970:-1 gene:WBGene00013658 transcript:Y105C5B.19 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRASKRPAPYPLLCEQKPEDLLVAPVEHKVYQDFEPKRPREFSPVMAQSLPPGEIDFQ
PSKIIFNAPYNENQESKIKLINTSALRIAYGINTYMKRLRVDTMCTPNCGVLDPSEEILL
TISCDAFAFGQVDTTNDRITVEWTNTSEGSTKQFCRDWLDGDGMVRRKTLPIEYSSSPIA
QTSSAPLLQASKHGMWLPIGFAASELYDYAKGEPLDRKTCEKNLEKLIKNDRDVDYYEWL
NFAKRCRTQNQNLMEEMALGMAFTTAMANKQHRKISRKAEKITEPITTNKAFSIDSAEKF
DRALTLPSRKWFMISDVVTDGDVSNWSTANLVTLVRALARTVFDKVAIADPHMMCYATSQ
NASTYIPIARDFFEGFAEYILGGFGEEQSRDLKFRVRKLVTDVMGNKLDRVRGRHNKMYG
NEASEDATRWLREQLRKEDGELKESRLIFPNGSEMMCNYQVNEENPEGSIKSEIFNDEEE
VEME
Download sequence
Identical sequences Q9NAM2
6239.Y105C5B.19 NP_502908.1.50509 Y105C5B.19 Y105C5B.19 Y105C5B.19 Y105C5B.19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]