SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y15E3A.1a.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y15E3A.1a.1
Domain Number 1 Region: 170-453
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-30
Family Nuclear receptor ligand-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 97-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.58e-29
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y15E3A.1a.1   Gene: WBGene00003681   Transcript: Y15E3A.1a.1
Sequence length 474
Comment pep:known chromosome:WBcel235:X:15309375:15314899:1 gene:WBGene00003681 transcript:Y15E3A.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVADSTSETPPVFDHDNLALAAQTNLLQFYLTHLASTLVPPMKLDMRDSMTPSFSQTES
PNSETDDSTSAANKVLFSILGTPTTDSTSNAVSKSSSKLCSVCGDKSTGLHYGAATCEGC
KGFFKRSVQNKKVYHCSQDNCCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGRN
GNSIYSNYKQRRSIIRKTKDYVEEQERRPFQSLPSGKKLIKELVEMDCLDRLINLKGLRI
NPSANCDIAPACKRLTRIGDEIVEQLVEWTKTLPFFDELPVEAHTHLLTQRWAELVLLSA
GYYACSVFTPDSPDTTEMIDETDEISFTNPQVNLRLLQNRLSLVLGKEIPLEHVAKEAGP
LVTRFTTLLHSFSNLKVSPEAYVCIKAITLLHLSADSTLDRSIIDKVNTLQDHFVKTLQI
HLHQPGEDAQTTSLAQILDWLPDLRNASSVLLHSKMFYVPFLLCKNPRRLVFDE
Download sequence
Identical sequences Q9U2R6
Y15E3A.1a.1 Y15E3A.1a.2 Y15E3A.1a.3 NP_001024953.1.50509 Y15E3A.1a Y15E3A.1 Y15E3A.1a.1 6239.Y15E3A.1a.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]