SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y17D7A.3a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y17D7A.3a
Domain Number 1 Region: 143-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.85e-36
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 11-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-22
Family Nuclear receptor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y17D7A.3a   Gene: WBGene00003655   Transcript: Y17D7A.3a
Sequence length 401
Comment pep:known chromosome:WBcel235:V:18839310:18845363:1 gene:WBGene00003655 transcript:Y17D7A.3a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEPCSSSPERCKVCGDTGNGMHFGAFTCRACAAFFRRAASRKFLRKCENHLIFALKCK
NCRLQRCYEAGMSSENFQFCRDLIGAKGAIPKLKVPKSFEQTVGRPYFVLQCDPEVLFLR
RNIIDCVPLLEKAEKLIEFGSESPVFSKNRLLKLAQGLQQFQDAKSNQVKFVQKMGQKEI
MSFFETDFLCATKWFTYLDEFQFLDKNQQLTLMQGIWHVWSRLHKLAVSAMGRRRGICDK
NTVMVSHQNEFAVCDLNEIEVDMSWCTNFSNEQMRYFLDTSHDSYVYQVMDEMLGLKPND
VELSYMMCQLCLQYAGQRFQGEILEFCEKMLGFLADDLHSYYVKQLRMPNYAARLAKLMK
INNRIKVDMLKMRQRQEISRVFDIWTIDFSHPEFIQDANAC
Download sequence
Identical sequences O45907
Y17D7A.3a Y17D7A.3a Y17D7A.3 6239.Y17D7A.3a NP_001024219.1.50509 Y17D7A.3a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]