SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y38E10A.19 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y38E10A.19
Domain Number 1 Region: 8-211
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.13e-18
Family Nuclear receptor ligand-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y38E10A.19   Gene: WBGene00012597   Transcript: Y38E10A.19
Sequence length 217
Comment pep:known chromosome:WBcel235:II:12640701:12642740:1 gene:WBGene00012597 transcript:Y38E10A.19 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSDEQILQFYVEHFEKALEKTQNVLLEFAESPLNHLKPTKRATDAQAFQFNSTCPGVE
NLNKLEREALFQQSSFVNLWLNLAYTCSKSSLSFWDSRDQGSEGGKLEVFMPRLHDSLTT
EFHRIHLDPQEFATICAITTWKIHQWGTVEANTVAGQHYLAVIKELNNHHKKTTTMRDFE
RALRITEIISLLVPIGRMLQEVKTLYETLGIKDDGRE
Download sequence
Identical sequences Q9NAJ2
Y38E10A.19 NP_496702.1.50509 Y38E10A.19 6239.Y38E10A.19 Y38E10A.19 Y38E10A.19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]