SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y38F2AL.5 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y38F2AL.5
Domain Number 1 Region: 10-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.00012
Further Details:      
 
Domain Number 2 Region: 124-269
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000129
Family Nuclear receptor ligand-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y38F2AL.5   Gene: WBGene00021417   Transcript: Y38F2AL.5
Sequence length 283
Comment pep:known chromosome:WBcel235:IV:2327126:2329640:-1 gene:WBGene00021417 transcript:Y38F2AL.5 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLCVGIPESQCCRVCGDRASGRHYGVLSCDGCRGFFKRSIRRNLRYSCKESGDCVIDVT
RRNQCQACRFQKCITVAMNRHAVQHERLGAPPEPKPTQTLIKAKRIRKPGIPEVIDPISD
PISCLSAVIRWWSSLPPANGFPASDRRIIFSNCWHSLFLFHVICQSGTSLVNDCNNEKLR
SISKTIKALNLNVVEQWAITVIIIYRSEDGRLESKSETLSTQIGAMQILAENHAARVFQS
RSTRCAQLLLIPLTIAQIAETEIREAFFPDCSVLDTVCRMAVH
Download sequence
Identical sequences Q9N418
Y38F2AL.5 Y38F2AL.5 NP_500190.3.50509 Y38F2AL.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]