SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y39B6A.17a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y39B6A.17a
Domain Number 1 Region: 152-369
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.77e-34
Family Nuclear receptor ligand-binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 12-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.52e-21
Family Nuclear receptor 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y39B6A.17a   Gene: WBGene00003685   Transcript: Y39B6A.17a
Sequence length 509
Comment pep:known chromosome:WBcel235:V:19076590:19082589:-1 gene:WBGene00003685 transcript:Y39B6A.17a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAKISHILPQKCEICKIQKCHGNHFGVNSCRACAAFFRRTVNSKWSRMRCLGGSCNQI
SFLCKPCRLQQCFNGGMMTNNFQYNRDVICPMDPQPTVSIPKSLEIYLGKPYFVMLSEKN
SEKTEIDLHRLLGEASKILSQGSASPSFCAGNQLKKLSLGLPNQIIAPRFKMAEKVAKAE
LVANWEYYVKKVAAWLAHFDDFRRLDVDLQMKLLQSIWHIWSRLEKLSATAKYRKTAQSY
KKTDVVLQGDIVVDVEHVYMDTRWLSNFPLEQFRRFMIHSSCDQYDVTQALYDLSPTDIE
LTYMLAQLCFQYAGNRYQGRILEVCDRFLTVLSNDLHDYYIKDLGMLRYAGRLAKMMQVN
NSIQKILCQKLAQQLPGPKFYITPVQKSTKFQNFQYRIFIDKPYDELLEKYVLNLHPNDH
RKLEKNLADFRKFHMENVVPQRFLADFYFQGTFENEEKLHNLTMEILKKYRKIDCLEEDE
AVQIHMEANHGKVQKSHPNRLKSWNSEIF
Download sequence
Identical sequences Q8MYP0
NP_001024229.1.50509 Y39B6A.17a Y39B6A.17a 6239.Y39B6A.17a Y39B6A.17A Y39B6A.17a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]