SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y39B6A.17b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y39B6A.17b
Domain Number 1 Region: 152-393
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.22e-42
Family Nuclear receptor ligand-binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 12-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.72e-22
Family Nuclear receptor 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y39B6A.17b   Gene: WBGene00003685   Transcript: Y39B6A.17b
Sequence length 399
Comment pep:known chromosome:WBcel235:V:19078215:19082589:-1 gene:WBGene00003685 transcript:Y39B6A.17b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAKISHILPQKCEICKIQKCHGNHFGVNSCRACAAFFRRTVNSKWSRMRCLGGSCNQI
SFLCKPCRLQQCFNGGMMTNNFQYNRDVICPMDPQPTVSIPKSLEIYLGKPYFVMLSEKN
SEKTEIDLHRLLGEASKILSQGSASPSFCAGNQLKKLSLGLPNQIIAPRFKMAEKVAKAE
LVANWEYYVKKVAAWLAHFDDFRRLDVDLQMKLLQSIWHIWSRLEKLSATAKYRKTAQSY
KKTDVVLQGDIVVDVEHVYMDTRWLSNFPLEQFRRFMIHSSCDQYDVTQALYDLSPTDIE
LTYMLAQLCFQYAGNRYQGRILEVCDRFLTVLSNDLHDYYIKDLGMLRYAGRLAKMMQVN
NSIQENIRKGRERMQLIRCFGVLKLEFSHPEMFLDSGFH
Download sequence
Identical sequences Q7YXC6
Y39B6A.17b Y39B6A.17b NP_001024230.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]