SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y40B10A.8.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y40B10A.8.2
Domain Number 1 Region: 173-402
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.39e-37
Family Nuclear receptor ligand-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 23-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.75e-30
Family Nuclear receptor 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y40B10A.8.2   Gene: WBGene00003676   Transcript: Y40B10A.8.2
Sequence length 407
Comment pep:known chromosome:WBcel235:V:2061111:2066844:-1 gene:WBGene00003676 transcript:Y40B10A.8.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLDNTSLEESQFRPEKKEKSTCSICREDGDGYHFGAEACRACAAFFRRSVSLDKTYLC
RGNNDCEITANIRCMCRSCRFAKCLEVGMNPAGVQQRRDTIGKREIKPDSTDLMQLLGSV
GDGYPPTTSAQSALVEDLHPSFNDRMPILMKMRVNYRKMDNARLVIHRKDGQSLFKEKTP
KAVNYKEACAQSIREVSLVADWVAWCFDDFVTLPMDQKKVLFRNFYTPFSVLEGAFLCHI
NDTSNALILPSGDYIDTNNLKSFFNIPDEEQPMTDDEIEKFCRMFKPSFELNRRGLVLPM
MAEKIDVFEFFALCTFVFWDFGLDEQTDDCMMIGKSVKDRVMKELAFYLRCAKRLEEPSL
RVASLLTLLPALQRCVRRFQEDIEITNVFNVYAPPKDFYDLVNGKFC
Download sequence
Identical sequences Q965W2
Y40B10A.8.1 6239.Y40B10A.8 Y40B10A.8.1 Y40B10A.8.2 NP_503561.2.50509 Y40B10A.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]