SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y41D4B.21b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y41D4B.21b
Domain Number 1 Region: 56-73,100-315
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-42
Family Nuclear receptor ligand-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y41D4B.21b   Gene: WBGene00021522   Transcript: Y41D4B.21b
Sequence length 317
Comment pep:known chromosome:WBcel235:IV:1638659:1644374:-1 gene:WBGene00021522 transcript:Y41D4B.21b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASAIQRRDVMGPRKPKIKESIVKTEIIEEVPKLIMSSNPSSTGSMSEGPPKHKRPLLE
DLVEVQRWQCSKHHSFFEAHEAINLDGDLSSMTYLKLNGTLHRRARARDVNSMLKLGLID
AATWGNQFDLFRRLSTEEKKHILTEFGFTFMLVDQGYKTAQKAEKGFWLLQNDTYMHEDY
FLGLPEEDARKENAATKAKLHPLFVNESLNCVGYPFKNLQIDEHECAVLKTILLLTQQGV
FKHCVNEVKHLYDCCMTELMGHSQRKYPDTAAERFGTIILLTSSIRCAINALYNQTRVSD
VFDLMKFDPLVRDVLLS
Download sequence
Identical sequences U4PEZ8
NP_001294520.1.50509 Y41D4B.21b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]