SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y41D4B.27 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y41D4B.27
Domain Number 1 Region: 129-356
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.44e-37
Family Nuclear receptor ligand-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-24
Family Nuclear receptor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y41D4B.27   Gene: WBGene00045255   Transcript: Y41D4B.27
Sequence length 365
Comment pep:known chromosome:WBcel235:IV:1627114:1630813:1 gene:WBGene00045255 transcript:Y41D4B.27 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPCPVCQALSNGFHFGVEVCSACSAFFRRTVFKKRNFRCWGEPVNCCEIVSTGSAFCK
SCRFAKCLAVGMKKETVQQGREGYGKREMALVPVISKFKANRQGLPILETIVETYSLLLN
VRICVHEGPNGSNSPKRDPKPVNYKETIACFLKEFYLVGDWLSHCFPEFAAFPVDQKDLL
HRNFYLQFVVLEGGFFSCNHKRSDIRYLPSGDYIDCVNPETYYYDPDGKQPMTPGEAVTL
FASSFQSYRRNVTHPMLRENADRFEFLALTGLALFDADLENISEETAAVCRKVRQKIQRN
MLKYYISTKSPEDASVRLGNLISIIPSLHRATRRFLEDIELSHVMKAYAVDEKFYDNCLP
KFGYL
Download sequence
Identical sequences A2V8C5
Y41D4B.27 Y41D4B.27 Y41D4B.27 NP_001122810.1.50509 6239.Y41D4B.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]