SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y42G9A.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Y42G9A.1
Domain Number - Region: 176-223
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y42G9A.1   Gene: WBGene00021531   Transcript: Y42G9A.1
Sequence length 301
Comment pep:known chromosome:WBcel235:III:6149982:6154933:1 gene:WBGene00021531 transcript:Y42G9A.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDSQESSFSVSKYETNDDGSMGQFISINECEREIQMLERDIRQQKESSANAKTAITFDQ
LRKIHTLSTLLGPHKELFFDRICRAADIQRASLKNRLKSNINKFEPSTPLSFQPGFDSQS
SLSTTSESQNFVVTPTTLSSLLNNHTRKNHIEMLAPLASEEELMRFPAERQFDLMQIGFS
YDEVKQLLEMFEKFKNDVQEINRLHTLTQILNQFCNYISMYAPPNLKMISSAFNLLELGN
SAHEVKRVLLKARRREESEESDVSFSKKPRPSSRSPASPNRDDLLLGLDRSPPSDDGTQK
V
Download sequence
Identical sequences Q9N4Z2
Y42G9A.1 Y42G9A.1 Y42G9A.1 6239.Y42G9A.1 Y42G9A.1 NP_498333.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]