SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y46H3D.5a.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y46H3D.5a.2
Domain Number 1 Region: 94-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-25
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y46H3D.5a.2   Gene: WBGene00003700   Transcript: Y46H3D.5a.2
Sequence length 326
Comment pep:known chromosome:WBcel235:V:1622498:1624398:-1 gene:WBGene00003700 transcript:Y46H3D.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPENIQYDRDKFESILKSSKNNRHLQIPNTVESQLCISPLVSFSNRREKSSKCIDISQI
VKKAVAKLLNPAMIRNIDSTSNLEQLTSGFKNLQSGQKENIPKIDHITLAHQTQHFNSSM
CSAAVWLGYSDRFKTYSDMQKIKVLQAIWCIWGRLEGIVMTAKMRIIGKCEKEQFFLTSD
TLIVYDNFSSDLDYCSTYPFEEMKYFFIPREMFHEDVISELVKVQPDDVETTYLMSVVCL
QLTGKRYGGLIQEEMEQFQDILSNDLHEYYINNKMPKYLLRIKQLMRVKEMFLRNLNIRM
EKYKIAGVFNVFNRPISNLEFFTVPI
Download sequence
Identical sequences Q966B9
Y46H3D.5a.1 Y46H3D.5a.2 NP_001041194.1.50509 Y46H3D.5a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]