SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y47D7A.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y47D7A.3
Domain Number 1 Region: 23-178,209-258
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000291
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y47D7A.3   Gene: WBGene00021617   Transcript: Y47D7A.3
Sequence length 315
Comment pep:known chromosome:WBcel235:V:4410617:4412401:1 gene:WBGene00021617 transcript:Y47D7A.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIERSFSGPRKYQNADEASLVPSPKLYTFEQAFNNPNLIFNRTKLTPTGKRFATSIDVM
QNFRRVFILFKDVLSVIPEFSKLCESDKMTLGKSRFSVFYWWLLCCWIAKCGSSGVCYSN
GSYFPLDTNFQPIPDLKGITELAIEAVSKPLARLCLTEEEILIGSVRKMRGIVFFFKQKI
NLFTKKFKNQKKIPSNMCLTRNHSSDPLPPKMPHASTQILSNARDRYIQCMINVSSCSEV
QSALRLAEISLIFPSITVGKLNGIKNSKSFQNFMTPKILNFQNLVHLTSDNIKVLDAMRV
LEADQLFRDVFIVKP
Download sequence
Identical sequences Y47D7A.3 Y47D7A.3 6239.Y47D7A.3 Y47D7A.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]