SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Y53F4B.19 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y53F4B.19
Domain Number 1 Region: 42-187
Classification Level Classification E-value
Superfamily PapD-like 1.88e-21
Family MSP-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y53F4B.19   Gene: WBGene00013165   Transcript: Y53F4B.19
Sequence length 338
Comment pep:known chromosome:WBcel235:II:15077273:15079475:1 gene:WBGene00013165 transcript:Y53F4B.19 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVSERDVDEYSKQKPETYVLQVSERERKEKYERKNPPIPLDNEYNYQDVTPSPFPFHI
DAPSLVFMGRLGEEPISAHFTLTNRTCKPFWFKIKVSSRELFKVRPTNGKLENSERVVIR
VIFYPNVRVPKPFCEYLHVYALFAGLGDRTAYEAFNRLDRQRTLPPKRLFTEFVWHPNIG
MTQAYENGKLMEMMRAKQKLLDYRKDENDKIKTFQVDFNNVIFDHRNRVLDRMLKANVVE
KEKLLYMPTPNLNLYMQNLRNQKNRSKLAVLLERRGDAFKGVQNLYAEEVLAKRTGDKMF
EKYKKKKGTKGYQSLDAKLYRPVKVVRNTKNKKKKGKK
Download sequence
Identical sequences Q9NAA1
Y53F4B.19 6239.Y53F4B.19 Y53F4B.19 NP_497104.2.50509 Y53F4B.19 Y53F4B.19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]