SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y57G11C.5a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y57G11C.5a
Domain Number 1 Region: 213-416
Classification Level Classification E-value
Superfamily Serpins 1.57e-16
Family Serpins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y57G11C.5a   Gene: WBGene00013303   Transcript: Y57G11C.5a
Sequence length 535
Comment pep:known chromosome:WBcel235:IV:14761826:14765433:-1 gene:WBGene00013303 transcript:Y57G11C.5a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNSKSTESRNKSQTSWNPFRKMLSMVTGRTGSESNSNTSDGEKTILRWTTACLTTTCP
IFSRNPQFNMIYCPVPSLLMYVIITLASENAMTKTLHRLFELTDSDVDEIREMAQKLAEL
QHPKHFYCFIRFLVDEQETTTVSKELMIKSNDVAFQQVFASFRPSRITKFLNSLTFSPVS
LNRPSLLTTNGYGSAGLNATWIGKTRKAGLNRFACTYHKKKNEEFFEIRTAYRTINMEQF
QVFEIPFKFGLSSACFGSLLILRPHLIGSLPYANRQLTTQSLSKMLDELYTAQWITEGRL
LLPQFSVDSCHDLWKNLMRHGVQPDLGQSQKAPPMASLWHWAHLRVGSEGIRGNVMTKKN
GAKLTASQKALQNTFHNRVDSDSLLKKHQSYAARIDSPFTYLVMVQGIPIFTGSYFGAPP
PKSTEIFINAPERIRHHRTYITKHRRYPKETRKQKLMRRVRKSEDREKEKDKKRARKEQK
NQKVENLEQSTTASSTSSLSSPEITVSKKPEIKNDDKSKSKGWRHLANRIFKRKN
Download sequence
Identical sequences O18231
Y57G11C.5a Y57G11C.5a Y57G11C.5a NP_001255826.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]