SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y5H2B.2b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y5H2B.2b
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-35
Family Nuclear receptor ligand-binding domain 0.007
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-20
Family Nuclear receptor 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y5H2B.2b   Gene: WBGene00003612   Transcript: Y5H2B.2b
Sequence length 425
Comment pep:known chromosome:WBcel235:V:2192497:2196826:1 gene:WBGene00003612 transcript:Y5H2B.2b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNPNSCEVCSSSSNSSCNHFGARTCKACAAFFRRTVSMKLDYQCIDQPDACRVHCDSR
VICRFCRLKKCHDIGMKPLLVKSKNERKNYIRISKGLIRKRSVLGDNVKENSEEIQNDDD
PQESDAEMENESTPGPSSEPSENVSAENQETVTKFLKLEASMCDRRRLLYAETPISIVLE
SGKEWPYENAPLKMFDYKLSQGMSKHDFVMIMDYARGMPGFDEMNYADSVFCYRLVCAVD
FVINSAYYTYKRGIEHNELVLSDGTFIPMVPTPLTGYEENANLLFQSQDDLMKFRTLMPL
ILHQWETCVPFAQLAPSHEEFCLLKAICVWHVSYYRLSEDGRRIAIAQRNRLIRALHHVC
HLDSDDVGERFGNVMMALNYIMVNIRHVVSSFVMISFFGIINVDKSMISLTSFWNKSDTS
TAPSL
Download sequence
Identical sequences Q9N4Q7
6239.Y5H2B.2b Y5H2B.2b Y5H2B.2b NP_001024269.1.50509 Y5H2B.2b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]