SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y67A6A.2a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y67A6A.2a
Domain Number 1 Region: 264-505
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-34
Family Nuclear receptor ligand-binding domain 0.00079
Further Details:      
 
Domain Number 2 Region: 95-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y67A6A.2a   Gene: WBGene00003652   Transcript: Y67A6A.2a
Sequence length 515
Comment pep:known chromosome:WBcel235:I:9839598:9844810:1 gene:WBGene00003652 transcript:Y67A6A.2a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSTLSPSAIDDILRHAVHFGQGTTAIAPSPVTFISTTTQQSLGATYPGVFNPTTPTFNH
YQHQALPVTMHTSTSSAHHTTTGHGRGRRKNSTINLVCVVCGDQAFGKHYGVNACNGCKG
FFRRSVWHNRQYLCRFEGRCAIAKEHRNVCRACRLKQCFVAGMNPRAVQSERVEREQNGS
PNQIEEDDYKDLSSPDTCSVEIQTDVDEQKPSSNNSAPLPSMELEMAKLSEQIVEMHRAV
CSYVDPVTKRENFDMKMETETTKIAFMNAFYNPEMIGPRTPLDITGRRVATVKDVMDEWK
RNFVLFSDWLRALPEYNQMSIEDQIVLAKNRYGTFHWWMCANWTVQAGCEGVCYSNGAYF
PKQPEAQCIPDVKGSSGRMYDSLSIPIKELNLDETEIVLMLAVIIFSDEITELADLTPAG
KEHVRMVGNRFVRMLHHHVNSKEYGEAMENGDDTQNSSESQAAVRIAKMMILLSATTNLV
YLTSDNIQLMEVLHVVPSEYLCHEVQFIQNSYETP
Download sequence
Identical sequences O02279
NP_492607.1.50509 6239.Y67A6A.2a Y67A6A.2a Y67A6A.2a Y67A6A.2 Y67A6A.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]